Recombinant Human Mitochondrial brown fat uncoupling protein 1 (UCP1)

In Stock
Code CSB-YP025554HU
MSDS
Size $250
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Transport
Alternative Names
mitochondrial brown fat uncoupling protein; Mitochondrial brown fat uncoupling protein 1; SLC25A7; Solute carrier family 25 member 7; Thermogenin; UCP 1; UCP; UCP1; UCP1_HUMAN; uncoupling protein 1 (mitochondrial, proton carrier); Uncoupling protein 1
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
2-307aa
Target Protein Sequence
GGLTASDVHPTLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYSGLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAGLTTGGVAVFIGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKEAFVKNNILADDVPCHLVSALIAGFCATAMSSPVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSKSRQTMDCAT
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
34.9kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Mitochondrial protein responsible for thermogenic respiration, a specialized capacity of brown adipose tissue and beige fat that participates in non-shivering adaptive thermogenesis to temperature and diet variations and more generally to the regulation of energy balance. Functions as a long-chain fatty acid/LCFA and proton symporter, simultaneously transporting one LCFA and one proton through the inner mitochondrial membrane. However, LCFAs remaining associated with the transporter via their hydrophobic tails, it results in an apparent transport of protons activated by LCFAs. Thereby, dissipates the mitochondrial proton gradient and converts the energy of substrate oxydation into heat instead of ATP. Regulates the production of reactive oxygen species/ROS by mitochondria.
Gene References into Functions
  1. Results suggest that G-quadruplex structure is a potential target to regulate the expression of uncoupling protein 1 (UCP1). PMID: 29796650
  2. Cellular and genetic evidence supported the regulation of UCP1 transcription by IRX3 as a direct mechanism on the browning program of white adipocytes. PMID: 28988979
  3. Multiple regression analysis showed that age, male gender, body max index, presence of obesity, type-2-diabetes mellitus, hypertension and coronary artery disease and left ventricular ejection fraction were associated with the expression levels of UCP1, PGC1alpha and PRDM16 mRNA PMID: 28824327
  4. Results found a specific fatty acids binding site that is functionally important to the H+ transport activity of UCP1-mediated flux. PMID: 28781081
  5. MKK6 acts as a repressor of UCP1 expression, suggesting that its inhibition promotes adipose tissue browning and increases organismal energy expenditure. PMID: 29021624
  6. determined transcriptional levels of UCP1 and UCP2 in peripheral blood mononuclear cells (PBMCs) from patients with metabolic disorders: type 2 diabetes, obesity and from healthy individuals. PMID: 29151065
  7. We observed that clozapine but not six other antipsychotic drugs reprogrammed the gene expression pattern of differentiating human adipocytes ex vivo, leading to an elevated expression of the browning marker gene UCP1, more and smaller lipid droplets and more mitochondrial DNA than in the untreated white adipocytes. PMID: 27898069
  8. The GG genotype of the UCP1-3826 A/G polymorphism appears to contribute to the onset of childhood obesity in Turkish children. The GG genotype of UCP1, together with the del/del genotype of the UCP2 polymorphism, may increase the risk of obesity with synergistic effects. The ins allele of the UCP2 exon 8 del/ins polymorphism may contribute to low HDL cholesterolemia. PMID: 28704105
  9. TENM2 knockdown induces both UCP1 mRNA and protein expression upon adipogenic differentiation without affecting mitochondrial mass. PMID: 28088466
  10. The role of UCP1 gene polymorphisms A-3826G, A-1766G, Met229Leu and Ala64Thr in susceptibility to obesity or metabolic syndrome was reviewed. PMID: 28100847
  11. Haplotype-based interaction between the PPARGC1A and UCP1 genes is associated with impaired fasting glucose (IFG) or type 2 diabetes mellitus (T2DM) among the residents of Henan province, China. Individuals with the haplotype AAG (PPARGC1A gene) and CTCG (UCP1 gene) have increased susceptibility to IFG or T2DM, while those with haplotype AAG (PPARGC1A gene) and CTCA (UCP1 gene) have a lower risk of IFG or T2DM. PMID: 28591028
  12. human and rodent Brown adipose tissue have similar UCP1 function per mitochondrion. PMID: 27508873
  13. glucocorticoids increased isoprenaline-stimulated respiration and UCP-1 in human primary brown adipocytes. PMID: 27411014
  14. These results reveal different characteristics in the biological actions between WAT and BAT in obese humans. Increased levels of IL6, UCP1 and SIRT1 in the BAT were associated with metabolic parameters improvements. PMID: 28073126
  15. UCP1 dietary activation can alleviate obesity. (Review) PMID: 28057582
  16. The molecular features of UCP1 support a conventional mitochondrial carrier-like mechanism. (Review) PMID: 28057583
  17. The history of discovery of UCP1, the mitochondrial uncoupling protein of brown adipocyte, has been described. (Review) PMID: 27916641
  18. Transcriptional regulation of the UCP1 protein in obesity and normal thermogenesis has been described. (Review) PMID: 27693079
  19. The H+ transport mediated by UCP1 was shown to be electrophoretic with a linear relation to the membrane potential. (Review) PMID: 27794497
  20. In the absence of purine nucleotides, UCP1 presents a high ohmic proton conductance that does not require the presence of activating ligands, such as fatty acids or retinoids. PMID: 27750036
  21. UCP1 is a transporter for H(+) and fatty acid anions. (Review) PMID: 27984203
  22. In inguinal white adipose tissue (iWAT) of mice fed a high-fat diet (HFD), Ucp1 level decreases concomitantly with increases in Cnot7 and its interacting partner Tob. PMID: 26711342
  23. Findings suggest that polymorphisms in SIRT6/UCP1 genes may be important for increased carotid plaque burden and echodensity PMID: 26332421
  24. UCP1 -3826 A>G polymorphism is associated with weight, body fat mass, and risk of type 2 diabetes mellitus in obese individuals candidates for bariatric surgery. PMID: 26458326
  25. UCP1 and UCP3 expression is associated with lipid and carbohydrate oxidation in patients submitted to bariatric surgery. PMID: 26959981
  26. 1-3826 A>G polymorphism associated with elevated lipid and apolipoprotein levels in Chinese population PMID: 25928572
  27. this study reveals that human adipose-derived stromal/progenitor cells can be readily differentiated into beige adipocytes that, upon activation, undergo uncoupling protein 1-dependent thermogenesis. PMID: 25389910
  28. This study suggests that the SNP rs1800592 in the UCP1 gene is associated with increased risk of PDR in the Chinese type 2 diabetes mellitus population. PMID: 25274455
  29. Genotype and allele distributions of UCP1, UCP2 and UCP3 polymorphisms did not differ significantly between obese and non-obese Type 2 Diabetes Mellitus patients.[Meta-analysis] PMID: 24752406
  30. Uncoupling protein 1 binds one nucleotide per monomer and is stabilized by tightly bound cardiolipin. PMID: 26038550
  31. Meta-analysis. There was no significant association of the UCP1-3826A/G polymorphism with BMI mean differences. PMID: 24804925
  32. By the application of these findings, we demonstrate that UCP1 is functionally thermogenic in intact brite adipocytes and adrenergic UCP1 activation is largely dependent on adipose triglyceride lipase (ATGL) rather than hormone sensitive lipase (HSL). PMID: 25135951
  33. BMI and TBF were significantly different among UCPI -3826A/G and UCP3 -55C/T genotype combinations, suggesting the existence of a gene interaction between UCP1 and UCP3 in influencing obesity and adiposity in multiethnic Malaysians. PMID: 25812254
  34. MED1 is required for optimal PRDM16-induced Ucp1 expression PMID: 25644605
  35. In obesity, in vitro differentiated beige/brite adipocytes derived from preadipocytes of human subcutaneous white adipose tissues express less UCP1. PMID: 24642703
  36. Human white adipocytes express the cold receptor TRPM8 which activation induces UCP1 expression, mitochondrial activation and heat production. PMID: 24342393
  37. UCP1 -3826A/G and ADRB3 Trp64Arg polymorphisms may have a combined effect in the modulation of overweight/obesity and HDL-C levels in type 2 diabetes mellitus (T2DM) Caucasian-Brazilian patients PMID: 24138564
  38. The season-specific effects of UCP1 on visceral fat area were consistent with a previous finding that active brown adipose tissue was more frequently found in winter than in summer. PMID: 24086366
  39. All-trans-retinoic acid (ATRA) induces UCP1 expression in mouse adipocytes through activation of RARs, whereas expression of UCP1 in human adipocytes is not increased by exposure to ATRA. PMID: 24059847
  40. VDR directly inhibits the expression of uncoupling protein-1 (UCP1). PMID: 23906633
  41. UCP1 -3826 A/G substitution accelerates age-related decrease in BAT activity, and thereby may associate with visceral fat accumulation with age. PMID: 23032405
  42. UCP1 can exist in different functional monomeric and associated states. PMID: 24196960
  43. UCP-1 is relatively abundant in epicardial fat, and this depot possesses molecular features characteristic of those found in vitro in beige lineage adipocytes. PMID: 23824424
  44. Compares and contrasts all the known human SLC25A* genes and includes functional information. PMID: 23266187
  45. High UCP1 expression is associated with pheochromocytoma. PMID: 23454374
  46. UCP-1 single nucleotide polymorphism A-3826G is associated with the dampness-phlegm pattern in Korean stroke patients. PMID: 23043591
  47. The present study demonstrates a sex-specific effect of genetic variants in UCP1 and SIRT3 on cIMT PMID: 22750084
  48. UCP1 in HEK293 cell mitochondria is fully inhibitable and does not contribute to basal proton conductance. PMID: 22676960
  49. These data are consistent with FTO rs9939609 and UCP-1 rs6536991 common variants as contributors to obesity in the Brazilian population. PMID: 23134754
  50. This study links the GG homozygous form of UCP1 with obesity and blood pressure among females only. PMID: 22764640

Show More

Hide All

Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Tissue Specificity
Brown adipose tissue.
Database Links

HGNC: 12517

OMIM: 113730

KEGG: hsa:7350

STRING: 9606.ENSP00000262999

UniGene: Hs.249211

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*